PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00456.1_g00015.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 301aa    MW: 32524.6 Da    PI: 9.0516
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00456.1_g00015.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.17.9e-3877136362
                   zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                              e+alkcprC+stntkfCy+nnysl+qPr+fCk+CrryWt+GG lrnvPvGgg r+n++++
  Rsa1.0_00456.1_g00015.1  77 EAALKCPRCESTNTKFCYFNNYSLTQPRHFCKGCRRYWTRGGVLRNVPVGGGYRRNRRTK 136
                              7789*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3360128IPR003851Zinc finger, Dof-type
PfamPF027011.5E-3179134IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.91980134IPR003851Zinc finger, Dof-type
PROSITE patternPS01361082118IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MVFSSIQAYL DSSNWQQAPP SNYNQSGAGP SETGGHGLCH QLQPQSQPLS NGSGVSGSIR  60
PGSMVDRARQ ANIAMPEAAL KCPRCESTNT KFCYFNNYSL TQPRHFCKGC RRYWTRGGVL  120
RNVPVGGGYR RNRRTKSSSN NNNNNSTATS NNTSFSSEAS GNASTISAIL SSNYGGNHES  180
ILSQFLSPGR LMNPNYNQHL GELLDNTKTD NSMSLFNYGG LSQDLRSVHM GTSGGSLMSC  240
VDPSSNGFYP FESPRTTSAS FSSALASQFS SVKVEDNPYK WVNVNGNCSS WTDLSTFGSS  300
R
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1120133RNVPVGGGYRRNRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893071e-150AC189307.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB033O04, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013627183.11e-167PREDICTED: dof zinc finger protein DOF2.4-like
SwissprotO809281e-144DOF24_ARATH; Dof zinc finger protein DOF2.4
TrEMBLA0A078CX781e-166A0A078CX78_BRANA; BnaC03g20790D protein
STRINGBra000008.1-P1e-159(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM113541732
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.11e-133DNA binding with one finger 2.4